Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) automatically mapped to Pfam PF02937 |
Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81412] (37 PDB entries) |
Domain d5w97i_: 5w97 I: [337689] Other proteins in same PDB: d5w97a_, d5w97b1, d5w97b2, d5w97c_, d5w97d_, d5w97e_, d5w97f_, d5w97g_, d5w97h_, d5w97j_, d5w97k_, d5w97l_, d5w97m_ automated match to d1v54i_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5w97 (more details), 2.3 Å
SCOPe Domain Sequences for d5w97i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w97i_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf eemrkagifqsak
Timeline for d5w97i_: