Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.0: automated matches [232406] (1 protein) not a true family |
Protein automated matches [232407] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries) |
Domain d5my6a2: 5my6 A:188-344 [337670] Other proteins in same PDB: d5my6a1, d5my6a3, d5my6b1, d5my6b2 automated match to d1n8zc3 complexed with gol, nag |
PDB Entry: 5my6 (more details), 2.25 Å
SCOPe Domain Sequences for d5my6a2:
Sequence, based on SEQRES records: (download)
>d5my6a2 g.3.9.0 (A:188-344) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg
>d5my6a2 g.3.9.0 (A:188-344) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd vgsctlvcplhnqevtaedgtqrcekcpcarvcyg
Timeline for d5my6a2: