Lineage for d5my6a2 (5my6 A:188-344)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3031041Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 3031042Protein automated matches [232407] (3 species)
    not a true protein
  7. 3031043Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)
  8. 3031044Domain d5my6a2: 5my6 A:188-344 [337670]
    Other proteins in same PDB: d5my6a1, d5my6a3, d5my6b1, d5my6b2
    automated match to d1n8zc3
    complexed with gol, nag

Details for d5my6a2

PDB Entry: 5my6 (more details), 2.25 Å

PDB Description: crystal structure of a her2-nb complex
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d5my6a2:

Sequence, based on SEQRES records: (download)

>d5my6a2 g.3.9.0 (A:188-344) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg

Sequence, based on observed residues (ATOM records): (download)

>d5my6a2 g.3.9.0 (A:188-344) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtaedgtqrcekcpcarvcyg

SCOPe Domain Coordinates for d5my6a2:

Click to download the PDB-style file with coordinates for d5my6a2.
(The format of our PDB-style files is described here.)

Timeline for d5my6a2: