| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) ![]() automatically mapped to Pfam PF02046 |
| Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
| Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries) |
| Domain d5x1fg_: 5x1f G: [337657] Other proteins in same PDB: d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fr_, d5x1fs_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_ automated match to d1v54g_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5x1f (more details), 2.2 Å
SCOPe Domain Sequences for d5x1fg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x1fg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek
Timeline for d5x1fg_:
View in 3DDomains from other chains: (mouse over for more information) d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1ff_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fr_, d5x1fs_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_ |