Lineage for d5x1bl_ (5x1b L:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2253970Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
    automatically mapped to Pfam PF02935
  5. 2253971Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. 2253972Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2253973Species Cow (Bos taurus) [TaxId:9913] [81424] (35 PDB entries)
  8. 2254040Domain d5x1bl_: 5x1b L: [337655]
    Other proteins in same PDB: d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1bd_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1bq_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1bz_
    automated match to d2occl_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1bl_

PDB Entry: 5x1b (more details), 2.4 Å

PDB Description: co bound cytochrome c oxidase at 20 nsec after pump laser irradiation to release co from o2 reduction center
PDB Compounds: (L:) cytochrome c oxidase subunit 7c, mitochondrial

SCOPe Domain Sequences for d5x1bl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1bl_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d5x1bl_:

Click to download the PDB-style file with coordinates for d5x1bl_.
(The format of our PDB-style files is described here.)

Timeline for d5x1bl_: