SCOPe 2.06: Domain d5x1ff_: 5x1f F:

Lineage for d5x1ff_ (5x1f F:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (35 PDB entries)

8. Domain d5x1ff_: 5x1f F: [337653]
   Other proteins in same PDB: d5x1fa_, d5x1fb1, d5x1fb2, d5x1fc_, d5x1fd_, d5x1fe_, d5x1fg_, d5x1fh_, d5x1fi_, d5x1fj_, d5x1fk_, d5x1fl_, d5x1fm_, d5x1fn_, d5x1fo1, d5x1fo2, d5x1fp_, d5x1fq_, d5x1fr_, d5x1ft_, d5x1fu_, d5x1fv_, d5x1fw_, d5x1fx_, d5x1fy_, d5x1fz_
   automated match to d1v54f_
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1ff_

PDB Entry: 5x1f, 2.2 Å

PDB Description: co bound cytochrome c oxidase without pump laser irradiation at 278k

PDB Compounds: (F:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d5x1ff_:

Sequence; same for both SEQRES and ATOM records:

>d5x1ff_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d5x1ff_:

• d5x1ff_ is new in SCOPe 2.06-stable
  
• d5x1ff_ appears in SCOPe 2.07
  
• d5x1ff_ appears in the current release, SCOPe 2.08