Class a: All alpha proteins [46456] (289 folds) |
Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) |
Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
Protein Cytochrome c oxidase subunit h [47696] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47697] (19 PDB entries) |
Domain d5w97h_: 5w97 H: [337628] Other proteins in same PDB: d5w97a_, d5w97b1, d5w97b2, d5w97c_, d5w97d_, d5w97e_, d5w97f_, d5w97g_, d5w97i_, d5w97j_, d5w97k_, d5w97l_, d5w97m_ automated match to d1v54h_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5w97 (more details), 2.3 Å
SCOPe Domain Sequences for d5w97h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w97h_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d5w97h_: