Lineage for d5lfgc_ (5lfg C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299707Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2299712Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (7 PDB entries)
  8. 2299723Domain d5lfgc_: 5lfg C: [337626]
    Other proteins in same PDB: d5lfgb_, d5lfgd_
    automated match to d1la6a_
    complexed with cmo, hem

Details for d5lfgc_

PDB Entry: 5lfg (more details), 1.94 Å

PDB Description: x-ray structure of a new fully ligated carbomonoxy form of trematomus newnesi hemoglobin (hb1tnco).
PDB Compounds: (C:) Hemoglobin subunit alpha-1

SCOPe Domain Sequences for d5lfgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lfgc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d5lfgc_:

Click to download the PDB-style file with coordinates for d5lfgc_.
(The format of our PDB-style files is described here.)

Timeline for d5lfgc_: