Lineage for d5w97b1 (5w97 B:1-90)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577253Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2577295Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2577296Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2577345Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 2577346Species Cow (Bos taurus) [TaxId:9913] [81454] (40 PDB entries)
  8. 2577414Domain d5w97b1: 5w97 B:1-90 [337624]
    Other proteins in same PDB: d5w97a_, d5w97b2, d5w97c_, d5w97d_, d5w97e_, d5w97f_, d5w97g_, d5w97h_, d5w97i_, d5w97j_, d5w97k_, d5w97l_, d5w97m_
    automated match to d1v54b2
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5w97b1

PDB Entry: 5w97 (more details), 2.3 Å

PDB Description: crystal structure of co-bound cytochrome c oxidase determined by serial femtosecond x-ray crystallography at room temperature
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5w97b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w97b1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d5w97b1:

Click to download the PDB-style file with coordinates for d5w97b1.
(The format of our PDB-style files is described here.)

Timeline for d5w97b1: