SCOPe 2.06: Domain d5vyga1: 5vyg A:43-84

Lineage for d5vyga1 (5vyg A:43-84)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (80 PDB entries)

8. Domain d5vyga1: 5vyg A:43-84 [337591]
   Other proteins in same PDB: d5vyga2, d5vygb2, d5vygc2, d5vygc3
   automated match to d1ccfa_
   complexed with ca, gxx

Details for d5vyga1

PDB Entry: 5vyg, 2.2 Å

PDB Description: crystal structure of hfa9 egf repeat with o-glucose trisaccharide

PDB Compounds: (A:) coagulation factor ix

SCOPe Domain Sequences for d5vyga1:

Sequence; same for both SEQRES and ATOM records:

>d5vyga1 g.3.11.1 (A:43-84) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdivdgdqcesnpclnggsckddinsyecwcpfgfegkncel

Timeline for d5vyga1:

• d5vyga1 is new in SCOPe 2.06-stable
  
• d5vyga1 appears in SCOPe 2.07
  
• d5vyga1 appears in the current release, SCOPe 2.08