Lineage for d1mgta2 (1mgt A:1-88)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1173005Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family) (S)
  5. 1173006Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)
  6. 1173010Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)
  7. 1173022Species Pyrococcus kodakaraensis [TaxId:311400] [53161] (1 PDB entry)
  8. 1173023Domain d1mgta2: 1mgt A:1-88 [33753]
    Other proteins in same PDB: d1mgta1
    complexed with so4

Details for d1mgta2

PDB Entry: 1mgt (more details), 1.8 Å

PDB Description: crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1
PDB Compounds: (A:) protein (o6-methylguanine-DNA methyltransferase)

SCOPe Domain Sequences for d1mgta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mgta2 c.55.7.1 (A:1-88) O6-alkylguanine-DNA alkyltransferase {Pyrococcus kodakaraensis [TaxId: 311400]}
mlsvekfrvgervvwigvifsgrvqgiafafdrgtlmkrihdlaehlgkrgvsisldvqp
sdypekvfkvligeldnasflrelsfeg

SCOPe Domain Coordinates for d1mgta2:

Click to download the PDB-style file with coordinates for d1mgta2.
(The format of our PDB-style files is described here.)

Timeline for d1mgta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mgta1