SCOPe 2.08: Domain d1mgta2: 1mgt A:1-88

Lineage for d1mgta2 (1mgt A:1-88)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families)

5. Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)

7. Species Pyrococcus kodakaraensis [TaxId:311400] [53161] (1 PDB entry)

8. Domain d1mgta2: 1mgt A:1-88 [33753]
   Other proteins in same PDB: d1mgta1
   complexed with so4
   has additional insertions and/or extensions that are not grouped together

Details for d1mgta2

PDB Entry: 1mgt, 1.8 Å

PDB Description: crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1

PDB Compounds: (A:) protein (o6-methylguanine-DNA methyltransferase)

SCOPe Domain Sequences for d1mgta2:

Sequence; same for both SEQRES and ATOM records:

>d1mgta2 c.55.7.1 (A:1-88) O6-alkylguanine-DNA alkyltransferase {Pyrococcus kodakaraensis [TaxId: 311400]}
mlsvekfrvgervvwigvifsgrvqgiafafdrgtlmkrihdlaehlgkrgvsisldvqp
sdypekvfkvligeldnasflrelsfeg

Timeline for d1mgta2:

• d1mgta2 first appeared (with stable ids) in SCOP 1.55
  
• d1mgta2 appears in SCOPe 2.07