Lineage for d5jboa_ (5jbo A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2096017Species Trichoderma harzianum [TaxId:5544] [319250] (3 PDB entries)
  8. 2096018Domain d5jboa_: 5jbo A: [337516]
    automated match to d1hxjb_

Details for d5jboa_

PDB Entry: 5jbo (more details), 1.97 Å

PDB Description: trichoderma harzianum gh1 beta-glucosidase thbgl2
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d5jboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jboa_ c.1.8.0 (A:) automated matches {Trichoderma harzianum [TaxId: 5544]}
lslpkdfewgfataayqiegavkeggrgpsiwdtychlepsrtngangdvacdhyhryde
dfdlltkygakayrfslswsriiplggrldpineegiqfysnlidallkrgvtpwvtlyh
wdlpqalhdryggwlnvkevqldferyarlcferfgdrvknwitinepwiqsiygyatgs
napgrssinkhstegdtttepwlagkaqimsharavavyskdfrasqkgqigislngdyy
epwdssdprdkeaaerrmefhigwyanpiflkkdypasmrkqlgdrlpaltpadfailna
getdfygmnyytsqfarhyegpvpktdflgaihehqenkdgspvgeesgifwlrscpdmf
rkhlarvhglygkpiyitengcpcpgedkmtceeaindpfriqyfdshldsiskaisqdg
vvvkgyfawalldnlewsdgygprfgvtytdyttlkrtpkksalvlkdmfadrqr

SCOPe Domain Coordinates for d5jboa_:

Click to download the PDB-style file with coordinates for d5jboa_.
(The format of our PDB-style files is described here.)

Timeline for d5jboa_: