Lineage for d5kyea_ (5kye A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497848Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 2497862Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species)
  7. 2497863Species Human (Homo sapiens) [TaxId:9606] [82570] (24 PDB entries)
  8. 2497876Domain d5kyea_: 5kye A: [337512]
    Other proteins in same PDB: d5kyec_, d5kyed_
    automated match to d1nbfa_
    complexed with epe; mutant

Details for d5kyea_

PDB Entry: 5kye (more details), 1.97 Å

PDB Description: crystal structure of usp7 catalytic domain [h294e] mutant in complex with ubiquitin
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d5kyea_:

Sequence, based on SEQRES records: (download)

>d5kyea_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
khtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyelq
hsdkpvgtkkltksfgwetldsfmqedvqelcrvlldnvenkmkgtcvegtipklfrgkm
vsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglqe
aekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpany
ilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsvr
hctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaq

Sequence, based on observed residues (ATOM records): (download)

>d5kyea_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
khtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyelq
hsdkpvgtkkltksfgwetldsfmqedvqelcrvlldnvenkmkgtcvegtipklfrgkm
vsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglqe
aekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpany
ilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlrhc
tnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaq

SCOPe Domain Coordinates for d5kyea_:

Click to download the PDB-style file with coordinates for d5kyea_.
(The format of our PDB-style files is described here.)

Timeline for d5kyea_: