Lineage for d5l2pc_ (5l2p C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153501Species Sulfolobus solfataricus [TaxId:2287] [337489] (1 PDB entry)
  8. 2153504Domain d5l2pc_: 5l2p C: [337490]
    automated match to d3wj1a_

Details for d5l2pc_

PDB Entry: 5l2p (more details), 2.56 Å

PDB Description: structure of arylesterase
PDB Compounds: (C:) Arylesterase

SCOPe Domain Sequences for d5l2pc_:

Sequence, based on SEQRES records: (download)

>d5l2pc_ c.69.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mpldpevrnflqvyykaniidftkyqfqeirqkvnellakavpkdpvgetrdmkikledy
elpiriyspikrtnnglvmhfhggawilgsietedaisrilsnscectvisvdyrlapey
kfptavydcfnaivwardnagelgidkdkiatfgisaggnlvaatsllardnklkltaqv
pvvpfvyldlasksmnryrkgyfldinlpvdygvkmyirdekdlynplfspliaedlsnl
pqaivvtaeydplrdqgeayayrlmesgvptlsfrvngnvhaflgsprtsrqvtvmigal
lkdifk

Sequence, based on observed residues (ATOM records): (download)

>d5l2pc_ c.69.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mpldpevrnflqvyykaniyqfqeirqkvnellakavpkdpvgetrdmkikledyelpir
iyspikrtnnglvmhfhggawilgsietedaisrilsnscectvisvdyrlapeykfpta
vydcfnaivwardnagelgidkdkiatfgisaggnlvaatsllardnklkltaqvpvvpf
vyldlasksmnryrkgyfldinlpvdygvkmyirdekdlynplfspliaedlsnlpqaiv
vtaeydplrdqgeayayrlmesgvptlsfrvngnvhaflgsprtsrqvtvmigallkdif
k

SCOPe Domain Coordinates for d5l2pc_:

Click to download the PDB-style file with coordinates for d5l2pc_.
(The format of our PDB-style files is described here.)

Timeline for d5l2pc_: