SCOPe 2.01: Domain d1qnta2: 1qnt A:6-91

Lineage for d1qnta2 (1qnt A:6-91)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family)

5. Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries)
   Uniprot P16455 6-176

8. Domain d1qnta2: 1qnt A:6-91 [33749]
   Other proteins in same PDB: d1qnta1

Details for d1qnta2

PDB Entry: 1qnt, 1.9 Å

PDB Description: x-ray structure of human o6alkylguanine-dna alkyltransferase

PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1qnta2:

Sequence, based on SEQRES records:

>d1qnta2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctaw
lnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records):

>d1qnta2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgkdavevpapaavlggpeplmqctawlnayf
hqpeaieefpvpalhhpvfqq

Timeline for d1qnta2:

• d1qnta2 first appeared (with stable ids) in SCOP 1.55
  
• d1qnta2 appears in SCOP 1.75
  
• d1qnta2 appears in SCOPe 2.02
  
• d1qnta2 appears in the current release, SCOPe 2.08