Lineage for d1qnta2 (1qnt A:6-91)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family) 
Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins) Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species) Species Human (Homo sapiens) [TaxId:9606] [53160] (4 PDB entries) 
Domain d1qnta2: 1qnt A:6-91 [33749]
Other proteins in same PDB: d1qnta1
Details for d1qnta2
PDB Entry: 1qnt (more details), 1.9 Å
PDB Description: x-ray structure of human o6alkylguanine-dna alkyltransferase
SCOP Domain Sequences for d1qnta2:
Sequence, based on SEQRES records: (download)
>d1qnta2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
emkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctaw
lnayfhqpeaieefpvpalhhpvfqq
Sequence, based on observed residues (ATOM records): (download)
>d1qnta2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
emkrttldsplgklelsgceqglheikllgkdavevpapaavlggpeplmqctawlnayf
hqpeaieefpvpalhhpvfqq
SCOP Domain Coordinates for d1qnta2:
Click to download the PDB-style file with coordinates for d1qnta2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qnta2:
- d1qnta2 appears in SCOP 1.57
- d1qnta2 appears in the current release, SCOPe 2.08
View in 3D
