![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) ![]() |
![]() | Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins) |
![]() | Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries) Uniprot P16455 6-176 |
![]() | Domain d1qnta2: 1qnt A:6-91 [33749] Other proteins in same PDB: d1qnta1 |
PDB Entry: 1qnt (more details), 1.9 Å
SCOPe Domain Sequences for d1qnta2:
Sequence, based on SEQRES records: (download)
>d1qnta2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]} emkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctaw lnayfhqpeaieefpvpalhhpvfqq
>d1qnta2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]} emkrttldsplgklelsgceqglheikllgkdavevpapaavlggpeplmqctawlnayf hqpeaieefpvpalhhpvfqq
Timeline for d1qnta2: