SCOPe 2.08: Domain d5gqea2: 5gqe A:311-436

Lineage for d5gqea2 (5gqe A:311-436)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Streptomyces olivaceoviridis [TaxId:1921] [225151] (7 PDB entries)

8. Domain d5gqea2: 5gqe A:311-436 [337483]
   Other proteins in same PDB: d5gqea1, d5gqeb1
   automated match to d2d1za2
   mutant

Details for d5gqea2

PDB Entry: 5gqe, 2.5 Å

PDB Description: crystal structure of michaelis complex of xylanase mutant (t82a, n127s, and e128h) from streptomyces olivaceoviridis e-86

PDB Compounds: (A:) Beta-xylanase

SCOPe Domain Sequences for d5gqea2:

Sequence; same for both SEQRES and ATOM records:

>d5gqea2 b.42.2.0 (A:311-436) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
gggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaag
tgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsn
qrwtrt

Timeline for d5gqea2:

• d5gqea2 first appeared in SCOPe 2.06
  
• d5gqea2 appears in SCOPe 2.07