Lineage for d5mx2v_ (5mx2 V:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981026Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981027Protein automated matches [190453] (22 species)
    not a true protein
  7. 2284404Species Thermosynechococcus elongatus [TaxId:197221] [327705] (4 PDB entries)
  8. 2294169Domain d5mx2v_: 5mx2 V: [337470]
    Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2d_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2o_, d5mx2u_
    automated match to d1e29a_
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2v_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d5mx2v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2v_ a.3.1.0 (V:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d5mx2v_:

Click to download the PDB-style file with coordinates for d5mx2v_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2v_:

  • d5mx2v_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-04