Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (26 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [327705] (4 PDB entries) |
Domain d5mx2v_: 5mx2 V: [337470] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2x_, d5mx2z_ automated match to d1e29a_ complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2v_ a.3.1.0 (V:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil vepkilgdkwgggkvyy
Timeline for d5mx2v_: