| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
| Protein automated matches [191005] (3 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [260559] (5 PDB entries) |
| Domain d5mx2u_: 5mx2 u: [337469] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2d_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2o_, d5mx2v_ automated match to d2axtu1 complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2u_ a.60.12.2 (u:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt
erqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d5mx2u_: