Lineage for d5mx2l_ (5mx2 L:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227335Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2227336Family f.23.31.1: PsbL-like [161018] (2 protein domains)
    Pfam PF02419
  6. 2227337Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 2227338Species Thermosynechococcus elongatus [TaxId:146786] [161020] (5 PDB entries)
    Uniprot Q8DIN8 1-37
  8. 2294166Domain d5mx2l_: 5mx2 L: [337467]
    Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2d_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2o_, d5mx2u_, d5mx2v_
    automated match to d2axtl1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2l_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5mx2l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
epnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d5mx2l_:

Click to download the PDB-style file with coordinates for d5mx2l_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2l_:

  • d5mx2l_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03