SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xdua1 (5xdu A:12-208)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2291105Species Staphylococcus aureus [TaxId:282458] [334406] (7 PDB entries)
  8. 2294163Domain d5xdua1: 5xdu A:12-208 [337464]
    Other proteins in same PDB: d5xdua2, d5xdua3
    automated match to d4m8ia1
    complexed with ca, gdp, zi6

Details for d5xdua1

PDB Entry: 5xdu (more details), 2 Å

PDB Description: staphylococcus aureus ftsz 12-316 complexed with txa6101
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d5xdua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdua1 c.32.1.1 (A:12-208) automated matches {Staphylococcus aureus [TaxId: 282458]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

SCOPe Domain Coordinates for d5xdua1:

Click to download the PDB-style file with coordinates for d5xdua1.
(The format of our PDB-style files is described here.)

Timeline for d5xdua1:

  • d5xdua1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03