Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) |
Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
Protein DNA repair protein MutS, domain II [53152] (2 species) |
Species Escherichia coli [TaxId:562] [53154] (8 PDB entries) Uniprot P23909 2-800 |
Domain d1e3ma3: 1e3m A:117-269 [33746] Other proteins in same PDB: d1e3ma1, d1e3ma2, d1e3ma4, d1e3mb1, d1e3mb2, d1e3mb4 complexed with adp, mg |
PDB Entry: 1e3m (more details), 2.2 Å
SCOPe Domain Sequences for d1e3ma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ma3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]} gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca agcllqyakdtqrttlphirsitmereqdsiim
Timeline for d1e3ma3:
View in 3D Domains from other chains: (mouse over for more information) d1e3mb1, d1e3mb2, d1e3mb3, d1e3mb4 |