Lineage for d5mx2f_ (5mx2 f:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227446Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2227447Family f.23.38.1: Cytochrome b559 subunits [161046] (3 protein domains)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2227467Protein automated matches [191000] (3 species)
    not a true protein
  7. 2283301Species Thermosynechococcus elongatus [TaxId:197221] [326602] (5 PDB entries)
  8. 2294157Domain d5mx2f_: 5mx2 f: [337458]
    Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2d_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2o_, d5mx2u_, d5mx2v_
    automated match to d2axtf1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2f_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5mx2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2f_ f.23.38.1 (f:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5mx2f_:

Click to download the PDB-style file with coordinates for d5mx2f_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2f_:

  • d5mx2f_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03