SCOPe 2.08: Domain d5mx2f_: 5mx2 f:

Lineage for d5mx2f_ (5mx2 f:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries)

8. Domain d5mx2f_: 5mx2 f: [337458]
   Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_
   automated match to d2axtf1
   complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2f_

PDB Entry: 5mx2, 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution

PDB Compounds: (f:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5mx2f_:

Sequence; same for both SEQRES and ATOM records:

>d5mx2f_ f.23.38.1 (f:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d5mx2f_:

• d5mx2f_ first appeared in SCOPe 2.06
  
• d5mx2f_ appears in SCOPe 2.07