SCOPe 2.06: Domain d5xlaa1: 5xla A:5-323

Lineage for d5xlaa1 (5xla A:5-323)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza a virus [TaxId:385590] [337343] (3 PDB entries)

8. Domain d5xlaa1: 5xla A:5-323 [337456]
   Other proteins in same PDB: d5xlaa2, d5xlab2
   automated match to d1ha0a1
   complexed with nag, sia; mutant

Details for d5xlaa1

PDB Entry: 5xla, 2.1 Å

PDB Description: the structure of hemagglutinin g228s mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5xlaa1:

Sequence; same for both SEQRES and ATOM records:

>d5xlaa1 b.19.1.0 (A:5-323) automated matches {Influenza a virus [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe

Timeline for d5xlaa1:

• d5xlaa1 is new in SCOPe 2.06-stable
  
• d5xlaa1 appears in SCOPe 2.07
  
• d5xlaa1 appears in the current release, SCOPe 2.08