SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xlaa1 (5xla A:5-323)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (32 species)
    not a true protein
  7. 2294042Species Influenza a virus [TaxId:385590] [337343] (3 PDB entries)
  8. 2294155Domain d5xlaa1: 5xla A:5-323 [337456]
    Other proteins in same PDB: d5xlaa2, d5xlab2
    automated match to d1ha0a1
    complexed with nag, sia; mutant

Details for d5xlaa1

PDB Entry: 5xla (more details), 2.1 Å

PDB Description: the structure of hemagglutinin g228s mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5xlaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlaa1 b.19.1.0 (A:5-323) automated matches {Influenza a virus [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe

SCOPe Domain Coordinates for d5xlaa1:

Click to download the PDB-style file with coordinates for d5xlaa1.
(The format of our PDB-style files is described here.)

Timeline for d5xlaa1:

  • d5xlaa1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5xlaa2