Lineage for d1ewrb3 (1ewr B:1117-1266)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25454Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) (S)
  5. 25455Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 25456Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 25460Species Thermus aquaticus [TaxId:271] [53153] (3 PDB entries)
  8. 25466Domain d1ewrb3: 1ewr B:1117-1266 [33745]
    Other proteins in same PDB: d1ewra1, d1ewra2, d1ewrb1, d1ewrb2

Details for d1ewrb3

PDB Entry: 1ewr (more details), 3.19 Å

PDB Description: crystal structure of taq muts

SCOP Domain Sequences for d1ewrb3:

Sequence, based on SEQRES records: (download)

>d1ewrb3 c.55.6.1 (B:1117-1266) DNA repair protein MutS, domain II {Thermus aquaticus}
tpgtllqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpa
evllapellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggal
slqpfrfydpgafmrlpeatlralevfepl

Sequence, based on observed residues (ATOM records): (download)

>d1ewrb3 c.55.6.1 (B:1117-1266) DNA repair protein MutS, domain II {Thermus aquaticus}
tpgtllqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpa
evllapellengafldefrklseapfepegegplalrrargallayaqrtqggalslqpf
rfydpgafmrlpeatlralevfepl

SCOP Domain Coordinates for d1ewrb3:

Click to download the PDB-style file with coordinates for d1ewrb3.
(The format of our PDB-style files is described here.)

Timeline for d1ewrb3: