Lineage for d5xl3a_ (5xl3 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2048164Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2048165Protein automated matches [227017] (34 species)
    not a true protein
  7. 2048242Species Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (9 PDB entries)
  8. 2048249Domain d5xl3a_: 5xl3 A: [337441]
    Other proteins in same PDB: d5xl3c_, d5xl3d_
    automated match to d4uoaa_
    complexed with gal, nag, sia

Details for d5xl3a_

PDB Entry: 5xl3 (more details), 2.2 Å

PDB Description: complex structure of h4 hemagglutinin from avian influenza h4n6 virus with lsta
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5xl3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl3a_ b.19.1.0 (A:) automated matches {Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqsgrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe

SCOPe Domain Coordinates for d5xl3a_:

Click to download the PDB-style file with coordinates for d5xl3a_.
(The format of our PDB-style files is described here.)

Timeline for d5xl3a_: