SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xl3d_ (5xl3 D:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2239322Protein automated matches [254646] (34 species)
    not a true protein
  7. 2294004Species Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337305] (9 PDB entries)
  8. 2294129Domain d5xl3d_: 5xl3 D: [337430]
    Other proteins in same PDB: d5xl3a_, d5xl3b_
    automated match to d4d00d_
    complexed with gal, nag, sia

Details for d5xl3d_

PDB Entry: 5xl3 (more details), 2.2 Å

PDB Description: complex structure of h4 hemagglutinin from avian influenza h4n6 virus with lsta
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d5xl3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl3d_ h.3.1.1 (D:) automated matches {Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xl3d_:

Click to download the PDB-style file with coordinates for d5xl3d_.
(The format of our PDB-style files is described here.)

Timeline for d5xl3d_:

  • d5xl3d_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03