SCOPe 2.08: Domain d5xl8b1: 5xl8 B:5-323

Lineage for d5xl8b1 (5xl8 B:5-323)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (12 PDB entries)

8. Domain d5xl8b1: 5xl8 B:5-323 [337428]
   Other proteins in same PDB: d5xl8a2, d5xl8b2, d5xl8c2
   automated match to d1ha0a1
   complexed with nag; mutant

Details for d5xl8b1

PDB Entry: 5xl8, 2 Å

PDB Description: the structure of hemagglutinin g228s mutant from a avian-origin h4n6 influenza virus (a/duck/czech/1956)

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5xl8b1:

Sequence; same for both SEQRES and ATOM records:

>d5xl8b1 b.19.1.0 (B:5-323) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe

Timeline for d5xl8b1:

• d5xl8b1 first appeared in SCOPe 2.06
  
• d5xl8b1 appears in SCOPe 2.07