Lineage for d1fw6a3 (1fw6 A:121-266)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 837560Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) (S)
  5. 837561Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 837562Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 837581Species Thermus aquaticus [TaxId:271] [53153] (4 PDB entries)
  8. 837584Domain d1fw6a3: 1fw6 A:121-266 [33742]
    Other proteins in same PDB: d1fw6a1, d1fw6a2, d1fw6a4, d1fw6b1, d1fw6b2, d1fw6b4

Details for d1fw6a3

PDB Entry: 1fw6 (more details), 2.7 Å

PDB Description: crystal structure of a taq muts-dna-adp ternary complex
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1fw6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fw6a3 c.55.6.1 (A:121-266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]}
llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
frfydpgafmrlpeatlralevfepl

SCOP Domain Coordinates for d1fw6a3:

Click to download the PDB-style file with coordinates for d1fw6a3.
(The format of our PDB-style files is described here.)

Timeline for d1fw6a3: