Lineage for d5xl2a1 (5xl2 A:5-323)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2294091Species Influenza a virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId:137611] [337392] (1 PDB entry)
  8. 2294117Domain d5xl2a1: 5xl2 A:5-323 [337418]
    Other proteins in same PDB: d5xl2a2, d5xl2b2, d5xl2c2
    automated match to d1ha0a1
    complexed with nag

Details for d5xl2a1

PDB Entry: 5xl2 (more details), 2.3 Å

PDB Description: the structure of hemagglutininfrom a swine-origin h4n6 influenza virus
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5xl2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl2a1 b.19.1.0 (A:5-323) automated matches {Influenza a virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId: 137611]}
gnpviclghhavsngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtcdivn
galgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvhhpst
dteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdlivfnt
ignliaprghyklnsqkkstilntavpigscvskchtdkgsisttkpfqnisrisigdcp
kyvkqgslklatgmrnipe

SCOPe Domain Coordinates for d5xl2a1:

Click to download the PDB-style file with coordinates for d5xl2a1.
(The format of our PDB-style files is described here.)

Timeline for d5xl2a1:

  • d5xl2a1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03