SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xdwa2 (5xdw A:209-315)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180721Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2180722Protein automated matches [226843] (8 species)
    not a true protein
  7. 2291107Species Staphylococcus aureus [TaxId:282458] [334408] (7 PDB entries)
  8. 2294113Domain d5xdwa2: 5xdw A:209-315 [337414]
    Other proteins in same PDB: d5xdwa1, d5xdwa3
    automated match to d4m8ia2
    complexed with ca, gdp

Details for d5xdwa2

PDB Entry: 5xdw (more details), 2 Å

PDB Description: staphylococcus aureus ftsz 12-316 g196s
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d5xdwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdwa2 d.79.2.0 (A:209-315) automated matches {Staphylococcus aureus [TaxId: 282458]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

SCOPe Domain Coordinates for d5xdwa2:

Click to download the PDB-style file with coordinates for d5xdwa2.
(The format of our PDB-style files is described here.)

Timeline for d5xdwa2:

  • d5xdwa2 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03