Lineage for d5xlab2 (5xla B:329-499)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2239599Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2239600Protein automated matches [254645] (21 species)
    not a true protein
  7. 2294044Species Influenza a virus [TaxId:385590] [337345] (3 PDB entries)
  8. 2294111Domain d5xlab2: 5xla B:329-499 [337412]
    Other proteins in same PDB: d5xlaa1, d5xlab1
    automated match to d1ha0a2
    complexed with nag, sia; mutant

Details for d5xlab2

PDB Entry: 5xla (more details), 2.1 Å

PDB Description: the structure of hemagglutinin g228s mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5xlab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlab2 h.3.1.0 (B:329-499) automated matches {Influenza a virus [TaxId: 385590]}
lfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektnd
kyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfer
vrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xlab2:

Click to download the PDB-style file with coordinates for d5xlab2.
(The format of our PDB-style files is described here.)

Timeline for d5xlab2:

  • d5xlab2 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5xlab1