Lineage for d5xlab1 (5xla B:5-323)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (32 species)
    not a true protein
  7. 2294042Species Influenza a virus [TaxId:385590] [337343] (3 PDB entries)
  8. 2294110Domain d5xlab1: 5xla B:5-323 [337411]
    Other proteins in same PDB: d5xlaa2, d5xlab2
    automated match to d1ha0a1
    complexed with nag, sia; mutant

Details for d5xlab1

PDB Entry: 5xla (more details), 2.1 Å

PDB Description: the structure of hemagglutinin g228s mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5xlab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlab1 b.19.1.0 (B:5-323) automated matches {Influenza a virus [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrgqssrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe

SCOPe Domain Coordinates for d5xlab1:

Click to download the PDB-style file with coordinates for d5xlab1.
(The format of our PDB-style files is described here.)

Timeline for d5xlab1:

  • d5xlab1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5xlab2