| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) ![]() |
| Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
| Protein DNA repair protein MutS, domain II [53152] (2 species) |
| Species Thermus aquaticus [TaxId:271] [53153] (4 PDB entries) |
| Domain d1ewqb3: 1ewq B:1121-1266 [33741] Other proteins in same PDB: d1ewqa1, d1ewqa2, d1ewqa4, d1ewqb1, d1ewqb2, d1ewqb4 CASP4 complexed with edo, so4 |
PDB Entry: 1ewq (more details), 2.2 Å
SCOP Domain Sequences for d1ewqb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewqb3 c.55.6.1 (B:1121-1266) DNA repair protein MutS, domain II {Thermus aquaticus}
llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
frfydpgafmrlpeatlralevfepl
Timeline for d1ewqb3:
View in 3DDomains from other chains: (mouse over for more information) d1ewqa1, d1ewqa2, d1ewqa3, d1ewqa4 |