SCOPe 2.06: Domain d5xl7a_: 5xl7 A:

Lineage for d5xl7a_ (5xl7 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (9 PDB entries)

8. Domain d5xl7a_: 5xl7 A: [337406]
   Other proteins in same PDB: d5xl7c_, d5xl7d_
   automated match to d4uoaa_
   complexed with gal, nag, sia; mutant

Details for d5xl7a_

PDB Entry: 5xl7, 2.1 Å

PDB Description: the structure of hemagglutinin q226l mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5xl7a_:

Sequence; same for both SEQRES and ATOM records:

>d5xl7a_ b.19.1.0 (A:) automated matches {Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrglsgrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe

Timeline for d5xl7a_:

• d5xl7a_ is new in SCOPe 2.06-stable
  
• d5xl7a_ appears in SCOPe 2.07
  
• d5xl7a_ appears in the current release, SCOPe 2.08