SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xl7a_ (5xl7 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (32 species)
    not a true protein
  7. 2293999Species Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (9 PDB entries)
  8. 2294105Domain d5xl7a_: 5xl7 A: [337406]
    Other proteins in same PDB: d5xl7c_, d5xl7d_
    automated match to d4uoaa_
    complexed with gal, nag, sia; mutant

Details for d5xl7a_

PDB Entry: 5xl7 (more details), 2.1 Å

PDB Description: the structure of hemagglutinin q226l mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5xl7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl7a_ b.19.1.0 (A:) automated matches {Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrglsgrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe

SCOPe Domain Coordinates for d5xl7a_:

Click to download the PDB-style file with coordinates for d5xl7a_.
(The format of our PDB-style files is described here.)

Timeline for d5xl7a_:

  • d5xl7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03