Lineage for d5vshl2 (5vsh L:107-213)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (647 PDB entries)
  8. 2294101Domain d5vshl2: 5vsh L:107-213 [337402]
    Other proteins in same PDB: d5vshb1, d5vshd1, d5vshf1, d5vshl1
    automated match to d1dn0a2
    complexed with so4

Details for d5vshl2

PDB Entry: 5vsh (more details), 2.55 Å

PDB Description: ch1/clambda fab based on pertuzumab
PDB Compounds: (L:) CH1/Clambda Fab light chain

SCOPe Domain Sequences for d5vshl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vshl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppskeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5vshl2:

Click to download the PDB-style file with coordinates for d5vshl2.
(The format of our PDB-style files is described here.)

Timeline for d5vshl2:

  • d5vshl2 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03