Lineage for d1ewqa3 (1ewq A:121-266)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 702610Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) (S)
  5. 702611Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 702612Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 702631Species Thermus aquaticus [TaxId:271] [53153] (4 PDB entries)
  8. 702632Domain d1ewqa3: 1ewq A:121-266 [33740]
    Other proteins in same PDB: d1ewqa1, d1ewqa2, d1ewqa4, d1ewqb1, d1ewqb2, d1ewqb4

Details for d1ewqa3

PDB Entry: 1ewq (more details), 2.2 Å

PDB Description: crystal structure taq muts complexed with a heteroduplex dna at 2.2 a resolution
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1ewqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewqa3 c.55.6.1 (A:121-266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]}
llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
frfydpgafmrlpeatlralevfepl

SCOP Domain Coordinates for d1ewqa3:

Click to download the PDB-style file with coordinates for d1ewqa3.
(The format of our PDB-style files is described here.)

Timeline for d1ewqa3: