Lineage for d5xvqb_ (5xvq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2294086Species Macaca mulatta [TaxId:9544] [337387] (1 PDB entry)
  8. 2294087Domain d5xvqb_: 5xvq B: [337388]
    automated match to d2i62b_
    complexed with 8gc, gol, sah

Details for d5xvqb_

PDB Entry: 5xvq (more details), 2.29 Å

PDB Description: crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna)
PDB Compounds: (B:) Nicotinamide N-methyltransferase (NNMT)

SCOPe Domain Sequences for d5xvqb_:

Sequence, based on SEQRES records: (download)

>d5xvqb_ c.66.1.0 (B:) automated matches {Macaca mulatta [TaxId: 9544]}
ftskdtylrhfnprdylekyykfgsrhsaesqilkhllenlfkifcldgvkgdllidigs
gptiyqllsacesfkeiivtdysdqnlqelekwlkkepeafdwspvvtyvcdlegnrvkg
pekeeklrqavkqvlkcdvtqsqplgavplpladcllstlcldaacpdlptyrralrnlg
sllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsyss
tmanneglfslvgrkls

Sequence, based on observed residues (ATOM records): (download)

>d5xvqb_ c.66.1.0 (B:) automated matches {Macaca mulatta [TaxId: 9544]}
ftskdtylrhfnprdylekyyksaesqilkhllenlfkifcldgvkgdllidigsgptiy
qllsacesfkeiivtdysdqnlqelekwlkkepeafdwspvvtyvcdlegnrvkgpekee
klrqavkqvlkcdvtqsqplgavplpladcllstlcldaacpdlptyrralrnlgsllkp
ggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsysstmann
eglfslvgrkls

SCOPe Domain Coordinates for d5xvqb_:

Click to download the PDB-style file with coordinates for d5xvqb_.
(The format of our PDB-style files is described here.)

Timeline for d5xvqb_:

  • d5xvqb_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03