SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xvqb_ (5xvq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (63 species)
    not a true protein
  7. 2294086Species Macaca mulatta [TaxId:9544] [337387] (1 PDB entry)
  8. 2294087Domain d5xvqb_: 5xvq B: [337388]
    automated match to d2i62b_
    complexed with 8gc, gol, sah

Details for d5xvqb_

PDB Entry: 5xvq (more details), 2.29 Å

PDB Description: crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna)
PDB Compounds: (B:) Nicotinamide N-methyltransferase (NNMT)

SCOPe Domain Sequences for d5xvqb_:

Sequence, based on SEQRES records: (download)

>d5xvqb_ c.66.1.0 (B:) automated matches {Macaca mulatta [TaxId: 9544]}
ftskdtylrhfnprdylekyykfgsrhsaesqilkhllenlfkifcldgvkgdllidigs
gptiyqllsacesfkeiivtdysdqnlqelekwlkkepeafdwspvvtyvcdlegnrvkg
pekeeklrqavkqvlkcdvtqsqplgavplpladcllstlcldaacpdlptyrralrnlg
sllkpggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsyss
tmanneglfslvgrkls

Sequence, based on observed residues (ATOM records): (download)

>d5xvqb_ c.66.1.0 (B:) automated matches {Macaca mulatta [TaxId: 9544]}
ftskdtylrhfnprdylekyyksaesqilkhllenlfkifcldgvkgdllidigsgptiy
qllsacesfkeiivtdysdqnlqelekwlkkepeafdwspvvtyvcdlegnrvkgpekee
klrqavkqvlkcdvtqsqplgavplpladcllstlcldaacpdlptyrralrnlgsllkp
ggflvimdalkssyymigeqkfsslplgreaveaavkeagytiewfevisqsysstmann
eglfslvgrkls

SCOPe Domain Coordinates for d5xvqb_:

Click to download the PDB-style file with coordinates for d5xvqb_.
(The format of our PDB-style files is described here.)

Timeline for d5xvqb_:

  • d5xvqb_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03