Lineage for d1dt9a1 (1dt9 A:143-276)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495356Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2495520Family c.55.4.2: ERF1/Dom34 middle domain-like [53143] (3 proteins)
    automatically mapped to Pfam PF03464
  6. 2495529Protein Middle domain of eukaryotic peptide chain release factor subunit 1, ERF1 [53144] (1 species)
  7. 2495530Species Human (Homo sapiens) [TaxId:9606] [53145] (2 PDB entries)
  8. 2495531Domain d1dt9a1: 1dt9 A:143-276 [33738]
    Other proteins in same PDB: d1dt9a2, d1dt9a3

Details for d1dt9a1

PDB Entry: 1dt9 (more details), 2.7 Å

PDB Description: the crystal structure of human eukaryotic release factor erf1-mechanism of stop codon recognition and peptidyl-trna hydrolysis
PDB Compounds: (A:) protein (eukaryotic peptide chain release factor subunit 1)

SCOPe Domain Sequences for d1dt9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dt9a1 c.55.4.2 (A:143-276) Middle domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]}
dskfgfividgsgalfgtlqgntrevlhkftvdlpkkhgrggqsalrfarlrmekrhnyv
rkvaetavqlfisgdkvnvaglvlagsadfktelsqsdmfdqrlqskvlklvdisyggen
gfnqaielstevls

SCOPe Domain Coordinates for d1dt9a1:

Click to download the PDB-style file with coordinates for d1dt9a1.
(The format of our PDB-style files is described here.)

Timeline for d1dt9a1: