Lineage for d5xy1a1 (5xy1 A:239-502)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (16 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (653 PDB entries)
  8. 2294077Domain d5xy1a1: 5xy1 A:239-502 [337378]
    Other proteins in same PDB: d5xy1a2
    automated match to d2bdfb_
    complexed with 8h0

Details for d5xy1a1

PDB Entry: 5xy1 (more details), 2.7 Å

PDB Description: crystal structure of lyn kinase domain in complex with n-(1h-indazol- 6-yl)-8-(piperidin-4-yloxy)-6-propylquinazolin-2-amine
PDB Compounds: (A:) tyrosine-protein kinase lyn

SCOPe Domain Sequences for d5xy1a1:

Sequence, based on SEQRES records: (download)

>d5xy1a1 d.144.1.7 (A:239-502) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aweipresiklvkrlgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanlmktlq
hdklvrlyavvtreepiyiiteymakgslldflksdeggkvllpklidfsaqiaegmayi
erknyihrdlraanvlvseslmckiadfglarviedneytaregakfpikwtapeainfg
cftiksdvwsfgillyeivtygkipypgrtnadvmtalsqgyrmprvencpdelydimkm
cwkekaeerptfdylqsvlddfyt

Sequence, based on observed residues (ATOM records): (download)

>d5xy1a1 d.144.1.7 (A:239-502) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aweipresiklvkrlgagqfgevwmgyynnstkvavktlkpgtmsvqafleeanlmktlq
hdklvrlyavvtreepiyiiteymakgslldflksdeggkvllpklidfsaqiaegmayi
erknyihrdlraanvlvseslmckiadfglarvkfpikwtapeainfgcftiksdvwsfg
illyeivtygkipypgrtnadvmtalsqgyrmprvencpdelydimkmcwkekaeerptf
dylqsvlddfyt

SCOPe Domain Coordinates for d5xy1a1:

Click to download the PDB-style file with coordinates for d5xy1a1.
(The format of our PDB-style files is described here.)

Timeline for d5xy1a1:

  • d5xy1a1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03

View in 3D
Domains from same chain:
(mouse over for more information)
d5xy1a2