Lineage for d5xldd_ (5xld D:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2239322Protein automated matches [254646] (34 species)
    not a true protein
  7. 2294004Species Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337305] (9 PDB entries)
  8. 2294075Domain d5xldd_: 5xld D: [337376]
    Other proteins in same PDB: d5xlda_, d5xldb_
    automated match to d4d00d_
    complexed with gal, nag, sia; mutant

Details for d5xldd_

PDB Entry: 5xld (more details), 2.3 Å

PDB Description: the structure of hemagglutinin q226l-g228s mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d5xldd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xldd_ h.3.1.1 (D:) automated matches {Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xldd_:

Click to download the PDB-style file with coordinates for d5xldd_.
(The format of our PDB-style files is described here.)

Timeline for d5xldd_:

  • d5xldd_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03