SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xlbd_ (5xlb D:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2239322Protein automated matches [254646] (34 species)
    not a true protein
  7. 2294004Species Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337305] (9 PDB entries)
  8. 2294074Domain d5xlbd_: 5xlb D: [337375]
    Other proteins in same PDB: d5xlba_, d5xlbb_
    automated match to d4d00d_
    complexed with nag; mutant

Details for d5xlbd_

PDB Entry: 5xlb (more details), 2.5 Å

PDB Description: the structure of hemagglutinin q226l-g228s mutant from an avian-origin h4n6 influenza virus
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d5xlbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlbd_ h.3.1.1 (D:) automated matches {Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xlbd_:

Click to download the PDB-style file with coordinates for d5xlbd_.
(The format of our PDB-style files is described here.)

Timeline for d5xlbd_:

  • d5xlbd_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03