SCOPe 2.06: Domain d5wifb1: 5wif B:1-175

Lineage for d5wifb1 (5wif B:1-175)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [337326] (1 PDB entry)

8. Domain d5wifb1: 5wif B:1-175 [337367]
   Other proteins in same PDB: d5wifb2, d5wifc2
   automated match to d4r9ma_
   complexed with bo3, k, peg, pg5

Details for d5wifb1

PDB Entry: 5wif, 2.5 Å

PDB Description: crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis

PDB Compounds: (B:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d5wifb1:

Sequence, based on SEQRES records:

>d5wifb1 d.108.1.0 (B:1-175) automated matches {Yersinia pestis [TaxId: 632]}
msttssvrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserrf
iiesqgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlykl
ylivdkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakykt

Sequence, based on observed residues (ATOM records):

>d5wifb1 d.108.1.0 (B:1-175) automated matches {Yersinia pestis [TaxId: 632]}
mstssvrlrpleredlpfvhqldsimrywfeepyeafvelcdlydkhihdqserrfiies
qgtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlyklyliv
dkenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakykt

Timeline for d5wifb1:

• d5wifb1 is new in SCOPe 2.06-stable
  
• d5wifb1 appears in SCOPe 2.07
  
• d5wifb1 appears in the current release, SCOPe 2.08