SCOPe 2.08: Domain d5vshb2: 5vsh B:107-213

Lineage for d5vshb2 (5vsh B:107-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5vshb2: 5vsh B:107-213 [337361]
Other proteins in same PDB: d5vsha_, d5vshb1, d5vshc_, d5vshd1, d5vshe_, d5vshf1, d5vshh_, d5vshl1
automated match to d1dn0a2
complexed with so4

Details for d5vshb2

PDB Entry: 5vsh (more details), 2.55 Å

PDB Description: ch1/clambda fab based on pertuzumab

PDB Compounds: (B:) CH1/Clambda Fab light chain

SCOPe Domain Sequences for d5vshb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vshb2 b.1.1.2 (B:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppskeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5vshb2:

Click to download the PDB-style file with coordinates for d5vshb2.
(The format of our PDB-style files is described here.)

Timeline for d5vshb2: