SCOPe 2.05: Domain d1hnwk_: 1hnw K:

Lineage for d1hnwk_ (1hnw K:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (2 species)

7. Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
   Uniprot P80376

8. Domain d1hnwk_: 1hnw K: [33736]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
   complexed with mg, tac, zn

Details for d1hnwk_

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d1hnwk_:

Sequence; same for both SEQRES and ATOM records:

>d1hnwk_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

Timeline for d1hnwk_:

• d1hnwk_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnwk_ appears in SCOPe 2.04
  
• d1hnwk_ appears in SCOPe 2.06
  
• d1hnwk_ appears in the current release, SCOPe 2.08