Lineage for d1hnwk_ (1hnw K:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.4: Translational machinery components [53137] (2 families) 
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) 
Protein Ribosomal protein S11 [53141] (1 species) Species Thermus thermophilus [TaxId:274] [53142] (6 PDB entries) 
Domain d1hnwk_: 1hnw K: [33736]
Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
Details for d1hnwk_
PDB Entry: 1hnw (more details), 3.4 Å
PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
SCOP Domain Sequences for d1hnwk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwk_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
SCOP Domain Coordinates for d1hnwk_:
Click to download the PDB-style file with coordinates for d1hnwk_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hnwk_:
- d1hnwk_ appears in SCOP 1.57
- d1hnwk_ appears in the current release, SCOPe 2.08
View in 3D
