SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wifa_ (5wif A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (41 species)
    not a true protein
  7. 2294025Species Yersinia pestis [TaxId:632] [337326] (1 PDB entry)
  8. 2294046Domain d5wifa_: 5wif A: [337347]
    Other proteins in same PDB: d5wifb2, d5wifc2
    automated match to d4r9ma_
    complexed with bo3, k, peg, pg5

Details for d5wifa_

PDB Entry: 5wif (more details), 2.5 Å

PDB Description: crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis
PDB Compounds: (A:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d5wifa_:

Sequence, based on SEQRES records: (download)

>d5wifa_ d.108.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
svrlrpleredlpfvhqldnnasimrywfeepyeafvelcdlydkhihdqserrfiiesq
gtkiglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlyklylivd
kenekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyk

Sequence, based on observed residues (ATOM records): (download)

>d5wifa_ d.108.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
svrlrpleredlpfvhqldsimrywfeepyeafvelcdlydkhihdqserrfiiesqgtk
iglvelveinhihrraefqiiidpthqgkgyagaaaklameygfsvlnlyklylivdken
ekaihiysklgfeiegelkqeffingeyrtvirmcifqpqylakyk

SCOPe Domain Coordinates for d5wifa_:

Click to download the PDB-style file with coordinates for d5wifa_.
(The format of our PDB-style files is described here.)

Timeline for d5wifa_:

  • d5wifa_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03